DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and st14a

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:266 Identity:104/266 - (39%)
Similarity:156/266 - (58%) Gaps:17/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFH-CGGSLLTKDY 131
            |.:|:.  .:||...||:|... :.::.|||||:.....::||...:......| ||||::.:.:
Zfish   571 DGQDDC--GDNSDESNCNCGTK-AYKKSRIVGGQDAFEGEFPWQVSLHIKNIAHVCGGSIINERW 632

  Fly   132 VLSAAHCVK---KLRKSK---IRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALL 190
            :::|||||:   |::.|:   ..|..|.|.|:  .:..|.:|.:..||.|..::..||:|||||:
Zfish   633 IVTAAHCVQDDVKIKYSQPGTWEVFLGLHSQK--DKLTATKRLLKQVIPHPYYNAYTYDNDIALM 695

  Fly   191 RLRKPISFSKIIKPICLP-RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQR 254
            .:..|::||..|:|:||| ..:..|||....:.|||.|.|||...:::.:.:|.|::.|.| || 
Zfish   696 EMESPVTFSDTIRPVCLPTATDTFPAGTSVFISGWGATREGGSGATVLQKAEVRIINSTVC-NQ- 758

  Fly   255 YKSTRITSSMLCAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSK 317
            ....:|||.|.|||..|  :|:|||||||||...:|.:.|:.|:||||.||.|...||:||.|.|
Zfish   759 LMGGQITSRMTCAGVLSGGVDACQGDSGGPLSFPSGKRMFLAGVVSWGDGCARRNKPGIYSNVPK 823

  Fly   318 FIPWIK 323
            |..|||
Zfish   824 FRAWIK 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 96/237 (41%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060 4/15 (27%)
Tryp_SPc 596..828 CDD:214473 94/235 (40%)
Tryp_SPc 597..831 CDD:238113 96/237 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.