DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Proz

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:274 Identity:67/274 - (24%)
Similarity:115/274 - (41%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YTENSSLKNC----DCDCG-FSNEEIRIVGGKPTGVNQYPWMARIV-YDGKFHCGGSLLTKDYVL 133
            |......|:|    .|.|| .::|.||:.....:..: :||..|:. .:|:..|.|.||.:|:||
Mouse   156 YKLGKDQKSCGPSDKCACGALTSEHIRMTKSSQSQPS-FPWQVRLTNSEGEDFCAGVLLQEDFVL 219

  Fly   134 SAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISF 198
            :.|.|  .|..|.|.| ..:.||.|..:|..:         |..:|.::..||::||:|.:|:..
Mouse   220 TTAKC--SLLHSNISV-KANVDQRIRIKSTHV---------HMRYDEESGENDVSLLQLEEPLQC 272

  Fly   199 SKIIKPICLPRYNYDP----AGRIGTVVGWGRTSEGGELPSIVNQVKVP-IMSITECRNQRYKST 258
            .....|:|:|..::..    .|..|.:.||  ...|..|.:      .| ::|:|:...:....|
Mouse   273 PSSGLPVCVPERDFAEHVLIPGTEGLLSGW--MLNGTHLAT------TPMLLSVTQADGEECGQT 329

  Fly   259 -RITSSMLCAGRPSMDSCQGDS--GGPLLLSNGV------KYFIVGIVSWGVGCGREGYPG---- 310
             .:|.:       :..||:..|  .||.:..:.|      .:|:.||:      |....||    
Mouse   330 LNVTVT-------TRTSCEKGSVVMGPWVEGSVVTREHKGTWFLTGIL------GSPPPPGQSQM 381

  Fly   311 -VYSRVSKFIPWIK 323
             :.:.|.::..|.|
Mouse   382 LLLTAVPRYSMWFK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 58/247 (23%)
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:291342 2/8 (25%)
Tryp_SPc 192..397 CDD:304450 58/238 (24%)
Trypsin 192..>340 CDD:278516 43/175 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.