DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:246 Identity:101/246 - (41%)
Similarity:149/246 - (60%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARI---VYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRV 149
            ||.:....:||||:..|...:||...:   .|.|.| |||||:.||:|||||||.:. ....|.|
Zfish    27 CGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHF-CGGSLINKDWVLSAAHCFQD-SIGTIMV 89

  Fly   150 IFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRY-NYD 213
            ..|...|..::..| |.:.|..||.|.:::..:.:|||||::|...::|:..|:|:||... |..
Zfish    90 KLGLQSQSGSNPYQ-ITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTY 153

  Fly   214 PAGRIGTVVGWGR-TSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG---RPSMDS 274
            .||.:..|.|||: :|...::|.|:.:|::||:|.::|:  |.....|||:|:|||   :...||
Zfish   154 AAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCK--RAYPGEITSNMICAGLLDQGGKDS 216

  Fly   275 CQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSN 325
            ||||||||::..||.::...||||:|.||...||||||:|||::..||.|:
Zfish   217 CQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 98/235 (42%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 96/233 (41%)
Tryp_SPc 36..264 CDD:238113 96/232 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.