DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and PRSS22

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:263 Identity:86/263 - (32%)
Similarity:129/263 - (49%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVK-KLRKSKIRVIF 151
            ||...:..|:|||:.:..:::||:..|..:|..||.|||||..:|::||||.| .|.|..:..:.
Human    41 CGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVL 105

  Fly   152 ---------GDHDQEITSESQAIQRAVTAVIKHKSFD-PDTYNNDIALLRLRKPISFSKIIKPIC 206
                     |...|::         .|..|..|..:. .:....||||:||.:.|.||:.:.|||
Human   106 LGAWQLGNPGSRSQKV---------GVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPIC 161

  Fly   207 LPRYN-YDPAGRIGTVVGWGRTSEGGEL--PSIVNQVKVPIMSITECRNQRYKST---RITSSML 265
            ||..: :.|......:.|||...:|..|  |..:.::||||:....|.:..::..   .||..||
Human   162 LPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDML 226

  Fly   266 CAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            |||  ....|:|.|||||||:......:.:.||:|||.||.....||||..:|....|::..::.
Human   227 CAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQG 291

  Fly   329 TCL 331
            ..|
Human   292 VQL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 82/246 (33%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.