DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss21

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:291 Identity:98/291 - (33%)
Similarity:142/291 - (48%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AFGLSDTEDEVEYTENSSLKNCDC---DCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGG 124
            |..|..|..:|: .|...|:..|.   .||......|||||....:.::||...:...|...||.
Mouse    19 AMALQSTYLQVD-PEKPELQEPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGA 82

  Fly   125 SLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQ--------EITS-------ESQAIQRAVTAVIK 174
            :||.:.:||:||||.:|           |:|.        |:||       ::.:.:..:..:..
Mouse    83 TLLNRRWVLTAAHCFQK-----------DNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFL 136

  Fly   175 HKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGT-VVGWGRTSEGGELPS--I 236
            ...:. :.|.||||||:|..|::::..|:||||....|....|... |.|||...|...|||  .
Mouse   137 SPKYS-EQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKFENRTDCWVTGWGAIGEDESLPSPNT 200

  Fly   237 VNQVKVPIMSITECRNQRYKS----TRITSSMLCAGRP--SMDSCQGDSGGPLLLSNGVKYFIVG 295
            :.:|:|.|::.:.| |..||.    |.|...|:|||.|  ..|:|.|||||||.......::.||
Mouse   201 LQEVQVAIINNSMC-NHMYKKPDFRTNIWGDMVCAGTPEGGKDACFGDSGGPLACDQDTVWYQVG 264

  Fly   296 IVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            :||||:||||...||||:.:|....||:|.:
Mouse   265 VVSWGIGCGRPNRPGVYTNISHHYNWIQSTM 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 87/251 (35%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 86/249 (35%)
Tryp_SPc 55..294 CDD:238113 87/251 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.