DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:111 Identity:39/111 - (35%)
Similarity:59/111 - (53%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGI 296
            |..:.|..||::..::|.|  .....||.:|:|||  :...|:||||||||::......:...||
Zfish    13 PRTLQQTVVPVVINSDCNN--LLGATITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCSVWVQSGI 75

  Fly   297 VSWGVGCGREGYPGVYSRVSKFIPWIKSNLE------------NTC 330
            :|.|..||:...||||:|||::..||.|::.            |:|
Zfish    76 ISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQNLPGFITFNPLNSC 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 36/92 (39%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 36/91 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.