DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and PRSS8

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:258 Identity:96/258 - (37%)
Similarity:134/258 - (51%) Gaps:16/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV-KKLRKS 145
            :..:..||.: .:.||.||......|:||...|.|:|...|||||:::.:|||||||. .:..|.
Human    31 EGAEAPCGVA-PQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKE 94

  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRY 210
            ...|..|.|..:..||...:. .:..:|.|.|:..:....|||||:|.:||:||:.|:|||||..
Human    95 AYEVKLGAHQLDSYSEDAKVS-TLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAA 158

  Fly   211 NYD-PAGRIGTVVGWGRTSEGGEL--PSIVNQVKVPIMSITECRNQRYKSTR-------ITSSML 265
            |.. |.|...||.|||..:....|  |..:.|::||::|...| |..|....       :...|:
Human   159 NASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETC-NCLYNIDAKPEEPHFVQEDMV 222

  Fly   266 CAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |||  ....|:|||||||||.......:::.||||||..||....||||:..|.:..||:|.:
Human   223 CAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 92/240 (38%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 91/238 (38%)
Tryp_SPc 45..284 CDD:238113 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.