DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and masp2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001116330.1 Gene:masp2 / 560277 ZFINID:ZDB-GENE-060130-154 Length:684 Species:Danio rerio


Alignment Length:262 Identity:89/262 - (33%)
Similarity:136/262 - (51%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEI-RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKS-KIRVI 150
            ||....:: :::||:....|:.||...|....||..|.|||:..:||:|||.||....| .:::.
Zfish   426 CGQPELKLSKVIGGENAEKNEIPWQVMIRMGTKFIGGASLLSDGWVLTAAHVVKSFEDSANLQLR 490

  Fly   151 FG---DHDQEITSESQAIQRAVTAVIKHKSFDPD--TYNNDIALLRLRKPISFSKIIKPICLP-- 208
            .|   .||.|      |:......:..|..:..|  .:|:||||::|...:..||.:.|:|||  
Zfish   491 MGTVKHHDNE------AVVGIPQKIFIHPQYHHDNVNFNHDIALIKLEYKVPVSKAVMPVCLPGR 549

  Fly   209 --RYNYDPAGRIGTVVGWGRTSEGGELPSI----VNQVKVPIMSITECRNQRYKST-------RI 260
              |:.. .|..:|.|.|||.::.  ..|::    :..|.:|:.:..:|:. :|.||       .:
Zfish   550 EERFVL-KANDVGKVSGWGVSNI--NTPALFSGNLKYVHLPVSNFNDCKT-KYDSTVTSKGKLVV 610

  Fly   261 TSSMLCAG--RPSMDSCQGDSGGPLLL--SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPW 321
            |.:|:|||  :...||||||||||...  .....:||.||||||.||.:.||.|||::||.::.|
Zfish   611 TENMICAGFSQGGKDSCQGDSGGPFAFFDKQSKSWFIGGIVSWGHGCAQAGYYGVYTKVSNYLSW 675

  Fly   322 IK 323
            |:
Zfish   676 IE 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 87/252 (35%)
masp2NP_001116330.1 CUB 24..130 CDD:214483
EGF_CA 134..176 CDD:214542
CUB 180..289 CDD:278839
CCP 296..357 CDD:214478
CCP 362..410 CDD:153056
Tryp_SPc 435..676 CDD:214473 85/250 (34%)
Tryp_SPc 436..679 CDD:238113 87/252 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.