DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:255 Identity:99/255 - (38%)
Similarity:141/255 - (55%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CDCD-CG---FSNEEIRIVGGKPTGVNQYPWMARI--VYDGKFHCGGSLLTKDYVLSAAHCVKKL 142
            |..| ||   .:|..    ||.......:||.|.|  :......|||||:.||:|||||||....
Zfish    22 CQLDVCGQAPLNNNN----GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMIT 82

  Fly   143 RKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICL 207
            ..:.|::..|...| ..|....|.|.:|.::.|..:...|.|||||||||...::|:..|:|:||
Zfish    83 ATANIKIFLGRQFQ-TGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCL 146

  Fly   208 PRYNYDPAGRIGT---VVGWGR-TSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG 268
            ...:...||  ||   :.||.: .|...::.:::.:|::|::|.||| |..||.. ||.:|:|||
Zfish   147 ASADSVFAG--GTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTEC-NADYKGI-ITDNMICAG 207

  Fly   269 --RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
              ....|:||||||||::..||.::...||||:|..||...|||:|:|||::..||.|.|
Zfish   208 INEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSEL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 92/235 (39%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 90/230 (39%)
Tryp_SPc 37..263 CDD:238113 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.