DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and prss60.2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:248 Identity:92/248 - (37%)
Similarity:139/248 - (56%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIV---YDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRV 149
            ||.:....|||||.......:||...:.   |.|.| |||||::.::||:||||:..:.:|.:.|
Zfish    25 CGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHF-CGGSLISSEWVLTAAHCLPGVSESSLVV 88

  Fly   150 IFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYN--Y 212
            ..|...|:..:..:. .|.|..:|.|.|::.:|.:||||||||...::|:..|:|:||...|  |
Zfish    89 YLGRRTQQGVNTHET-SRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVY 152

  Fly   213 DPAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMD 273
            . ||....:.|||....|..||:  |:.:..:|:::...| |.:..|..:|::|:|||  :...|
Zfish   153 S-AGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC-NAQLGSGTVTNNMICAGLAKGGKD 215

  Fly   274 SCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            :||||||||::......:...||.|||.||.....||||:|||::..||.|.:
Zfish   216 TCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/236 (37%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 87/234 (37%)
Tryp_SPc 34..267 CDD:238113 88/236 (37%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4142
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.