DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss2

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:299 Identity:98/299 - (32%)
Similarity:157/299 - (52%) Gaps:53/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SGVSNAFGLSDTEDEVE-----YTENS-------SLKNCDCDCGFSNEEIRIVGGKPTGVNQYPW 110
            ||.::...|:.:...|:     |..:|       ||:..:|.......:.|||||.......:||
Mouse   203 SGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPW 267

  Fly   111 MARIVYDGKFHCGGSLLTKDYVLSAAHCVKK--------------LRKSKIRVIFGDHDQEITSE 161
            ...:...|...||||::|.:::::|||||::              ||:|  .:.:|...|     
Mouse   268 QVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQS--LMFYGSRHQ----- 325

  Fly   162 SQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGT-----V 221
                   |..||.|.::|..|.||||||::|:.|::|:.::||:|||    :|...:..     :
Mouse   326 -------VEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLP----NPGMMLDLDQECWI 379

  Fly   222 VGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLL 284
            .|||.|.|.|:...::|...||::..::|.::...:..||.:|:|||  :.|:|||||||||||:
Mouse   380 SGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLV 444

  Fly   285 -LSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
             |.||: ::::|..|||.||.:...||||..|:.|..||
Mouse   445 TLKNGI-WWLIGDTSWGSGCAKALRPGVYGNVTVFTDWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/248 (35%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897 9/43 (21%)
Tryp_SPc 254..485 CDD:238113 88/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.