DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss44

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:255 Identity:88/255 - (34%)
Similarity:136/255 - (53%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152
            ||  :...|||||||..:.::||...:....:..|||||::|.:|::|||||           :|
  Rat   106 CG--HRTARIVGGKPAPIRKWPWQVSLQVHKQHICGGSLISKWWVMTAAHCV-----------YG 157

  Fly   153 DHDQEITS------ESQAIQRAVTAVIKHKSFD-PDTYNNDIALLRLRKPISFSKIIKPICLPRY 210
            ..|..::.      .|.:::..|..:|.|:.:. ..|..:||||:.|..|:::|..|:|:|:|..
  Rat   158 HLDYVVSMGEADLWSSMSVKIPVQDIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVCIPEK 222

  Fly   211 NY--DPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKS------TRITSSMLCA 267
            ::  .| |.:..|.|||:|.|.|....::.:|.:.|:....| ||..|.      |.:....:|.
  Rat   223 SFLVQP-GTLCWVTGWGKTIERGRSSRVLREVDLSIIRHERC-NQILKDITGRIFTLVQEGGVCG 285

  Fly   268 -GRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
             .:...|:||||||||::......:..|||||||:||||.||||:|:.||.:..||...|
  Rat   286 YNKKGGDACQGDSGGPMVCEFNKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWIIKEL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 84/243 (35%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 83/241 (34%)
Tryp_SPc 113..341 CDD:238113 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.