DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss53

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:264 Identity:76/264 - (28%)
Similarity:123/264 - (46%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ENSSLKNCDCDCGFSNEEIRIVGGKPTG-VNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHC-V 139
            |||.:.     ||..:.     ||...| ::|:||.||:.:.||..|||:|:::..||:|||| :
  Rat   329 ENSCVA-----CGSLSS-----GGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFI 383

  Fly   140 KKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKP 204
            .:....:..|..|...:|         ..:..:|.|.::......:|:|.|.|.:|::....::|
  Rat   384 GRQTLEEWSVGLGAGPEE---------WGLKQLILHGAYTHPEGGHDVAFLLLAQPVTLGPGLRP 439

  Fly   205 ICLPRYNYD-PAGRIGTVVGWGRTSEGGELPSIVNQ---VKVPIMSITECRNQRYKS----TRIT 261
            :|||..::. |.|..|.|:  |.|.|.|     :|.   |.|.::....|..|...|    ..|.
  Rat   440 LCLPYADHRLPDGEHGWVL--GLTREAG-----INHPHTVPVTVLGPMACSRQHAASGSTGVPIL 497

  Fly   262 SSMLC---AGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIK 323
            ..|:|   .|.|  ..|:|.||.||:......:|:.|:.|:|..|.....|.|::.:|.:..|: 
  Rat   498 PGMICTTVVGEP--PHCEGLSGAPLVHEIRGTWFLAGLHSFGDTCQGSAKPAVFAALSAYEDWV- 559

  Fly   324 SNLE 327
            |||:
  Rat   560 SNLD 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 68/240 (28%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 68/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.