DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss33

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:253 Identity:95/253 - (37%)
Similarity:135/253 - (53%) Gaps:16/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV-KKLRKSKIRVIF 151
            ||......|||||:.....::||...|.:.|...|||||:...:||:|.||. :::..|:..|:.
  Rat    25 CGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHCFSRRVLPSEYSVLL 89

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR-YNYDPA 215
            |....::|| |..:...|..|:....:..|....|:|||:|..|:|.|..|:|:|||. .::.|.
  Rat    90 GALSLDVTS-SHELLVPVLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQPVCLPAPGSHPPP 153

  Fly   216 GRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRY-------KSTRIT-SSMLCAG-- 268
            |....|.|||..|.|..||.  .:..|:||::....| ::.|       ||.||. ...||||  
  Rat   154 GSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRAC-DRLYHMGANVPKSERIVLPGNLCAGYR 217

  Fly   269 RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |...|:|||||||||......::.:||:||||.||.....||||:.|:|:.|||::.|
  Rat   218 RGHKDACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRPGVYTNVAKYSPWIQARL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 91/241 (38%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 90/239 (38%)
Tryp_SPc 34..272 CDD:238113 90/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.