DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss36

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:321 Identity:102/321 - (31%)
Similarity:152/321 - (47%) Gaps:53/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SDAINTIHTGHNKRTSKFLFDTIFRISSGVSNAF---GLSDTEDEVEYTENSSLKNCDCDCGFSN 92
            :.::.|..|.|          .:|.:.|....||   .:|.|:.|.|          |.|||...
  Rat    10 ASSLQTFLTPH----------LVFSVVSPTPGAFQDSAVSPTQGEFE----------DLDCGRPE 54

  Fly    93 EEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIR------VIF 151
            ...|||||.......:||...:.:.|...|||||:...:|||||||.  :....:.      |:.
  Rat    55 PSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCF--VTNGTLEPADEWSVLL 117

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNN-----DIALLRLRKPISFSKIIKPICLPRYN 211
            |.|.|:...|...::...|.::      ||.|:.     |:|||||..|......:||:||||.:
  Rat   118 GVHSQDGPLEGAHMRSVATILV------PDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRAS 176

  Fly   212 YDPA-GRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITEC-----RNQRYKST-RITSSMLCA 267
            :..| |......|||...|...||.  ::.:|::.::..|.|     |...:..| ::...||||
  Rat   177 HLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCA 241

  Fly   268 GRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            |.|.  .|:|||||||||:..:|.::|:.||.|:|.||||...|||::.|:.:..||:.::
  Rat   242 GYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWIREHV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/249 (35%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 86/249 (35%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.