DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and prss36

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:256 Identity:92/256 - (35%)
Similarity:129/256 - (50%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLR-KSKIRVIF 151
            ||......|||||.......:||...:.|.|...||||::...::|:||||.:..: .|...|..
 Frog   376 CGSPLVSSRIVGGTDAREGAWPWQVSLRYRGSHICGGSVIGTQWILTAAHCFENSQFPSDYEVRL 440

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLP-RYNYDPA 215
            |.:....||.:: |...|..:|.:..||..|...||||:||..||:::|.|.|:||| ..|....
 Frog   441 GTYRLAQTSPNE-ITYTVDRIIVNSQFDSSTLFGDIALIRLTSPITYTKYILPVCLPSTSNSFTD 504

  Fly   216 GRIGTVVGWGRTSEGGEL--PSIVNQVKVPIMSITECRNQRY--------KSTRITSSMLCAGRP 270
            |....|.|||..|....|  |..:.:|..|:::.|.| :|.|        .|..|.|..:|:|..
 Frog   505 GMECWVTGWGTISLYVNLPYPKTLQEVMTPLINRTRC-DQMYHIDSPVSASSEIIPSDQICSGYS 568

  Fly   271 S--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLENT 329
            :  .|||:|||||||:......::.:||||||.||.....||||:.|..:..|:.:. |||
 Frog   569 AGGKDSCKGDSGGPLVCKLQGIWYQIGIVSWGEGCAIAKRPGVYTLVPAYYSWVIAE-ENT 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/241 (36%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113
Tryp_SPc 385..622 CDD:238113 85/238 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.