DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and KLK14

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:242 Identity:81/242 - (33%)
Similarity:131/242 - (54%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EEIRIVGGKPTGVNQYPWMARIVYD--GKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD 155
            :|.:|:||.....:..||.|.::..  .:|.|||:||:..:|::||||.:.:    ::|..|.|:
Human    21 DENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPI----LQVALGKHN 81

  Fly   156 QEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGT 220
            ......:|.:.|.|..| .|.:::..|::||:.||:|::|....:.::||.:.:....| |....
Human    82 LRRWEATQQVLRVVRQV-THPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASP-GTSCR 144

  Fly   221 VVGWGRTSEG-GELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP--SMDSCQGDSGGP 282
            |.|||..|.. ...|:.:..|.:.|.....|: :.|..| ||..|:|||.|  ..||||||||||
Human   145 VSGWGTISSPIARYPASLQCVNINISPDEVCQ-KAYPRT-ITPGMVCAGVPQGGKDSCQGDSGGP 207

  Fly   283 LLLSNGVKYFIVGIVSWGV-GCGREGYPGVYSRVSKFIPWIKSNLEN 328
            |:....::    |:||||: .|...||||||:.:.|:..||:..:.:
Human   208 LVCRGQLQ----GLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 80/233 (34%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.