DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and aqrs

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:389 Identity:72/389 - (18%)
Similarity:123/389 - (31%) Gaps:162/389 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKYIIFFWMLTANYSSVLSL-EYSKGFNESDAINTIHTGHNKRTSKFLFDTIFRISSGVSNAF 64
            |.|.:.....:|..:||:.|.: :||:.::.....|..|.                         
  Fly     1 MRLLFTCILSILGMDYSASLWIKKYSENYHRPTYYNRAHR------------------------- 40

  Fly    65 GLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGV---NQYPWMA--------RIVYDG 118
                |:|.|:|                |.|......||..|   .:.|:.|        .::.:|
  Fly    41 ----TKDHVDY----------------NREALEERDKPKPVEVQKRLPFDATRDLTYYVNVLNEG 85

  Fly   119 KFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDP--- 180
            ...|.|:|:::..|:::.||.:..|...|        .|.|::..:|   :|.|....:.:|   
  Fly    86 SVICAGALISRRMVVTSTHCFQPRRFDLI--------YEYTAKHLSI---LTGVELDDNPEPHQV 139

  Fly   181 ----------DTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPS 235
                      :.:.|.:|||.|...:...|         |.|.|..|              :.|.
  Fly   140 IGFFMPVNKNERFTNYVALLALSNKLDRDK---------YRYIPLHR--------------KKPQ 181

  Fly   236 IVNQVKVP---------------IMSITEC----------------------RNQRYKSTRITSS 263
            ..:.||:.               :|.|..|                      ||:|: |.:.|  
  Fly   182 AGDDVKMAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRH-SKKTT-- 243

  Fly   264 MLCAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREG---YPGVYSRVSKFIPWIKS 324
              |:.||         |.|||:.|.    :..|..:|..|..:.   ...:|..:...||:|::
  Fly   244 --CSTRP---------GDPLLIDNK----LAAINIYGEHCDEDDDSTNMDIYLPIRPVIPFIQT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 56/292 (19%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 50/259 (19%)
Tryp_SPc 83..268 CDD:304450 46/236 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.