DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG7432

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:259 Identity:99/259 - (38%)
Similarity:142/259 - (54%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DCGFSNEEI---RIVGGKPTGVNQYPWMARIVYDG----KFHCGGSLLTKDYVLSAAHCVKKLRK 144
            :||  .:|.   |||||......|:||||.|...|    :|.|||||:...|:|:||||.:..|:
  Fly   464 ECG--QQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQ 526

  Fly   145 S-----KIRVIFGDHDQEITSE-SQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIK 203
            .     :..|..||.|....:| |..:..||..|..|:.|....:.||||:|.|.||:..||.:.
  Fly   527 KPFAARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVI 591

  Fly   204 PICLPRYNYDP-----AGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSS 263
            |:|||:....|     .||..||||||.|..||:..:...|.::||....:|....::.  |..:
  Fly   592 PVCLPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQP--INEN 654

  Fly   264 MLCAGRP--SMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSN 325
            .:|||..  .:|:|||||||||::.....:..:|:||:|..||..||||||:||::::.||:.:
  Fly   655 FICAGYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRDH 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 95/244 (39%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 94/242 (39%)
Tryp_SPc 475..718 CDD:238113 95/244 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.