DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG7142

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:216 Identity:66/216 - (30%)
Similarity:110/216 - (50%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HCGGSLLTKDYVLSAAHCVKKLRKSKIRVIF-GDHD-QEITSESQAIQ-RAVTAVIKHKSFDPDT 182
            :|.|:::.:.::|:||||:...:..:..||. |.|| .:...|:..|| |.:...::|:.:....
  Fly   109 YCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGV 173

  Fly   183 YNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGG--ELPSIVNQVKVPIM 245
            ...||||:..::|:.|...::|..||..:..|.| .||:.|||..|...  ..|..:.:..:||:
  Fly   174 NPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEG-YGTLYGWGNVSMTAVPNYPHRLQEANMPIL 237

  Fly   246 SITECRNQRYKS-TRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVKYF-----IVGIVSWG-V 301
            .:..|.....:| ..:..:.||.|  ...:..|..||||||:.....::|     ::|||||| :
  Fly   238 DMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKM 302

  Fly   302 GCGREGYPGVYSRVSKFIPWI 322
            .||::..|.|:.|||.|..||
  Fly   303 PCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 66/216 (31%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 66/216 (31%)
Tryp_SPc 84..323 CDD:214473 64/214 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.