DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and ea

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:294 Identity:106/294 - (36%)
Similarity:156/294 - (53%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NSSLKNCDCDCG--FSNEEIRIVGGKPTGVNQYPWMARIVY---DGK--FHCGGSLLTKDYVLSA 135
            ::||......||  .||   ||.||..|.::::||||.|.|   .||  .||||||::..||::|
  Fly   110 SNSLLPLPGQCGNILSN---RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITA 171

  Fly   136 AHCV--KKL----RKSKIRVIFGDHDQEITSESQAIQRA------------VTAVIKHKSFDPDT 182
            :|||  |.|    |.|.:|:  |:.|.....:.:...|.            |...|.|..:.|.:
  Fly   172 SHCVNGKALPTDWRLSGVRL--GEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234

  Fly   183 YN--NDIALLRLRKPISFSKIIKPICLP------RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQ 239
            .|  ||||||||.:.:.::..::|||||      ...:|  |....|.|||:|.   :|.:...:
  Fly   235 KNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFD--GITMDVAGWGKTE---QLSASNLK 294

  Fly   240 VKVPI--MSITECRNQRYKSTRI--TSSMLCA-GRPSMDSCQGDSGGPL--LLSNGVK--YFIVG 295
            :|..:  ..:.||:|. |.|..|  ..:.:|| |:..:|||:|||||||  |.:|.|.  ||:.|
  Fly   295 LKAAVEGFRMDECQNV-YSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAG 358

  Fly   296 IVSWG-VGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            :||:| ..||..|:||||:.|.|::.||::.:|:
  Fly   359 VVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 98/268 (37%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 97/266 (36%)
Tryp_SPc 128..389 CDD:238113 98/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.