DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG3916

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:246 Identity:79/246 - (32%)
Similarity:125/246 - (50%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQ-YPWMARIVYD--GKFH--CGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD 155
            ||.||:  .||: .|:...:...  |::.  ||||:::..:||:||||::|::...:.|:.|   
  Fly    30 RINGGQ--RVNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVG--- 89

  Fly   156 QEITSESQAIQRAVTAVIKH----KSFDPDTYNNDIALLRLRKPISFSKI-IKPICLPRYNYDPA 215
             .:..::..::..:  |.||    .|.:|... |||||:::..|....:. |..|.:     ..:
  Fly    90 -TLNWKAGGLRHRL--VTKHVHPQYSMNPRII-NDIALVKVTPPFRLERSDISTILI-----GGS 145

  Fly   216 GRIGTVV-----GWGRTS---EGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCA-GRPS 271
            .|||..|     |||.||   ....||..:..:....:|..:| ||  |..|:|.:.:|| ....
  Fly   146 DRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDC-NQ--KGFRVTRNEICALAVQG 207

  Fly   272 MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            ..:|.|||||| |:..|.:..:|||||:|.....:|.|.||:|||.|:|:|
  Fly   208 QGACVGDSGGP-LIRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 78/245 (32%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 78/244 (32%)
Tryp_SPc 31..260 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.