DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss45

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:260 Identity:73/260 - (28%)
Similarity:123/260 - (47%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFSNEEIRIVGGKP------TGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKI 147
            |::.:....|.|.|      ...:.:||...:..:.:..|||:|:.:.:|:|||||::  ...:.
  Rat    36 GYNEDHAEPVCGAPWWSDSLEERHHWPWEVSLQIENEHVCGGALIDQSWVVSAAHCIQ--GNKEY 98

  Fly   148 RVIFGDHDQEITSESQAIQRAVTAVIKH-KSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYN 211
            .|:.|....:.:....|::..|..:|.| |.:..:...:|||||.|..|::|:|.|:|||||.:|
  Rat    99 LVMLGSSTLQPSGSPWALKIPVGDIIMHPKYWGQNFIRSDIALLCLETPVTFNKYIQPICLPEHN 163

  Fly   212 YD-PAGRIGTVVGWGRTSEGGELPSI-------VNQVKVPIMSITECRNQRYKST-------RIT 261
            :: ..|....|.|||:..:.   ||.       :.:.:|.|:....|....:|.|       .|.
  Rat   164 FNLKVGMKCWVTGWGQAKQH---PSAKLTRSLELWEAEVSIVDNKNCDRVFHKKTFYPQVIPLIR 225

  Fly   262 SSMLCAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            .:|:|......:.|.||.||||......::.:.||.||...|.:.....||:|:.|:..|||..:
  Rat   226 KNMICTTNHRENPCYGDPGGPLACEVHGRWILAGIFSWEKACTKAPNLSVYTRIDKYTGWIKEQV 290

  Fly   327  326
              Rat   291  290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 72/249 (29%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 69/236 (29%)
Tryp_SPc 57..286 CDD:214473 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.