DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:364 Identity:105/364 - (28%)
Similarity:167/364 - (45%) Gaps:57/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YIIFFWMLTANYSSVLSLEYS---------------KGFNESDAINTIHTGH----NKRTSKFLF 50
            |.:.|.:...:|.|..:..||               :.|:||.........|    :|...|.:.
  Rat    64 YHVSFKVNNIDYDSKFAKPYSQEYMDLNKRIVSLMNETFHESKLRKQYVKAHTVQVSKAKGKVVI 128

  Fly    51 DTIFRISSGVSNAFGLSDTEDEVE-------------YTENSSLKNCDCDCGFSNEEI-----RI 97
            ..:.:..|...|  .:....|.||             ..::||.|...|    ....|     ::
  Rat   129 HGVLKFKSCYKN--NVEKFWDSVETILYQKLKSQTRLLIDSSSFKFSGC----GRRTITPGGHKV 187

  Fly    98 VGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHC-VKKLRKSKIRVIFGDHDQEITSE 161
            .||:.....::||.|.:..:....||.:|::..::::|||| |:.......:|.||    .:.|:
  Rat   188 AGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFG----FLLSK 248

  Fly   162 SQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR--YNYDPAGRIGTVVGW 224
            .|| ||||.:::.|:::....:|||||::||..|:.:...|:..|||.  ..:.|...: .|.||
  Rat   249 PQA-QRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDV-VVTGW 311

  Fly   225 GRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLL-- 285
            |.....|:.|:|:.:.:|.|:....|.:.:.....||..|||||  ...:|:|||||||||:.  
  Rat   312 GTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGPLVSED 376

  Fly   286 SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKS 324
            |.|: :|:.||||||..|.....||||:||:.:..||.|
  Rat   377 SKGI-WFLAGIVSWGDECALPNKPGVYTRVTHYRDWISS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 83/235 (35%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699 17/94 (18%)
Tryp_SPc 186..412 CDD:214473 80/232 (34%)
Tryp_SPc 187..415 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.