DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG4613

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:334 Identity:116/334 - (34%)
Similarity:172/334 - (51%) Gaps:54/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ESDAINTIHTGHNKRTSKFLFDTIFRISSGVSNAFGL-----SDTEDEVEYTENSS--------- 80
            :||.|:.:..||.::.              :||..|:     |||...:..|..||         
  Fly    62 QSDFIDDLIEGHKQQI--------------LSNVLGVASETPSDTASSLGSTSLSSSASPVFPLE 112

  Fly    81 --------LKNC-DCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAA 136
                    :..| .|.||..|.. |||||.....|:|||:|:|:......|||:|:...|||:||
  Fly   113 GGGAKAFRVNRCASCTCGVPNVN-RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAA 176

  Fly   137 HCV--KKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFS 199
            |||  ..:|...:|::..|.    :|....:.|:|.....|..:||.:..:|||||||.:||...
  Fly   177 HCVHGMDMRGVSVRLLQLDR----SSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLV 237

  Fly   200 KIIKPICLPR---YNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRIT 261
            ..::|.|||.   .|:|....|  |.|||.:.|||...|::.:|.|||::..:||...|:| .|.
  Fly   238 DTMRPACLPSNWLQNFDFQKAI--VAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRS-MIV 299

  Fly   262 SSMLCAG---RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIK 323
            .:|:|||   ....|:|||||||||::.:.: :.:.|:||:|.||.:...||||:|||:::.||.
  Fly   300 DTMMCAGYVKTGGRDACQGDSGGPLIVRDRI-FRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIA 363

  Fly   324 SNLENTCLC 332
            .|..::|.|
  Fly   364 VNTRDSCYC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 93/235 (40%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 92/233 (39%)
Tryp_SPc 137..362 CDD:238113 91/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471773
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
99.000

Return to query results.
Submit another query.