DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG4477

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:230 Identity:63/230 - (27%)
Similarity:101/230 - (43%) Gaps:40/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIR-----VIFGDHDQEITSESQAIQRAVTAVIKHK 176
            |..| |.|.:|...:|:::|||:...|:..|.     ::.|..::.....::.....||.:    
  Fly    68 DNHF-CSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRTFVTPVTHI---- 127

  Fly   177 SFDPDTY----NNDIALLRLRKPISFSKIIKPICLPRYNYDP--AGRIGTVVGWGRTSEGGELPS 235
             :.||::    ..|..||:::.|  |.:..:.|.:.|....|  .|....|:||||..:||.|.|
  Fly   128 -WLPDSFTMRNKQDFGLLKVKNP--FPRNNEHISIARLPVHPPLPGLKCKVMGWGRMYKGGPLAS 189

  Fly   236 IVNQVKVPIMSITECRNQRYKSTRITS-SMLCAGRPSMDS--------CQGDSGGPLLLSNGVKY 291
            .:..:.|.::....|.    |..|:.| ..:||    :||        |.||.|.| :|.||..|
  Fly   190 YMLYIDVQVIDSEACA----KWLRVPSVEHVCA----VDSDDLTAQQPCGGDWGAP-MLHNGTVY 245

  Fly   292 FIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            .||.|::   |||....|.:|:.|.....||...:
  Fly   246 GIVTILA---GCGVSHLPSLYTNVHSNANWIHEKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 63/227 (28%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 63/227 (28%)
Tryp_SPc 55..273 CDD:214473 61/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.