DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG6462

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:314 Identity:79/314 - (25%)
Similarity:133/314 - (42%) Gaps:90/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYD----GK 119
            |..| |.|...:.|:|..:.::::.            ||.||:......:|:...:|..    ..
  Fly    52 GYEN-FRLRCEKFEMEGNQTAAVRT------------RIAGGELATRGMFPYQVGLVIQLSGADL 103

  Fly   120 FHCGGSLLTKDYVLSAAHCVKKLRKSKI---RVIFGDHDQEITSESQAIQRAVTAVIKHKSF--D 179
            ..|||||:|..:||:||||:.....:||   ..:|.|.:..:    :.:|      :.|:.|  .
  Fly   104 VKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSV----EELQ------VTHRDFIIY 158

  Fly   180 PDTYN----NDIALLRLRKPISFSKIIKPICLP----RYNYDPAGRIGTVVGWGRTSEGGE---- 232
            ||...    :|:||:||.:.:..|:.::||.|.    ..|: ..|::.|:.|||...:..:    
  Fly   159 PDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNF-LVGKVVTLSGWGYLGDSTDKRTR 222

  Fly   233 -------------------LPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCA-GRPSMDSCQG 277
                               ||.:|:|             :|:         ||. |.....:|.|
  Fly   223 LLQYLDAEVIDQERCICYFLPGLVSQ-------------RRH---------LCTDGSNGRGACNG 265

  Fly   278 DSGGPLLLS-NGVKYFIVGIVSWGVGCGRE-GYPGVYSRVSKFIPWIKSNLENT 329
            |||||::.. ..|.| ::|:.|:|...|.| |.|.||:|::.::|||:.....|
  Fly   266 DSGGPVVYHWRNVSY-LIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 71/270 (26%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 70/268 (26%)
Tryp_SPc 77..314 CDD:238113 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.