powered by:
Protein Alignment CG11836 and CG1273
DIOPT Version :9
Sequence 1: | NP_001356925.1 |
Gene: | CG11836 / 43007 |
FlyBaseID: | FBgn0039272 |
Length: | 333 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647883.1 |
Gene: | CG1273 / 38522 |
FlyBaseID: | FBgn0035522 |
Length: | 1168 |
Species: | Drosophila melanogaster |
Alignment Length: | 46 |
Identity: | 11/46 - (23%) |
Similarity: | 20/46 - (43%) |
Gaps: | 3/46 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 LEYSKGFNESDAINTIHTGHNKRTSKFLFDTI---FRISSGVSNAF 64
::.|:....:|....|:...|.:....:|||: ..|:..|.|.|
Fly 940 IDKSENLTLNDIKTRINNASNIQDISLIFDTLASKLGITPSVPNKF 985
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11836 | NP_001356925.1 |
Tryp_SPc |
97..325 |
CDD:238113 |
|
CG1273 | NP_647883.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BGTX |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.