DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG1273

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_647883.1 Gene:CG1273 / 38522 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster


Alignment Length:46 Identity:11/46 - (23%)
Similarity:20/46 - (43%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEYSKGFNESDAINTIHTGHNKRTSKFLFDTI---FRISSGVSNAF 64
            ::.|:....:|....|:...|.:....:|||:   ..|:..|.|.|
  Fly   940 IDKSENLTLNDIKTRINNASNIQDISLIFDTLASKLGITPSVPNKF 985

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113
CG1273NP_647883.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGTX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.