DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG1299

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:270 Identity:91/270 - (33%)
Similarity:149/270 - (55%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYD----GKFHCGGSLLTKDYVLSAAHCVKKL 142
            :.|....|:..   :||||:.:....:||:|.:.||    ..|.|||:|:|..:||:||||:   
  Fly   249 EGCGSTVGYFK---KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI--- 307

  Fly   143 RKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICL 207
            |:....|..|:||....:|:..:...:...:.|..::.....:|:|:|.|.:.:.|:..|.||||
  Fly   308 RQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL 372

  Fly   208 P------RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITEC-----RNQRYKST-RI 260
            |      :.:|  .|.:..|.|||:|.||||...::|::::||.....|     :.:||.|. :.
  Fly   373 PHTANLRQKSY--VGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQF 435

  Fly   261 TSSMLCAGRPS--MDSCQGDSGGPLLL----SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFI 319
            ..::||||..|  .|:|||||||||:|    ...::::::|:||:|:||.|...|||||....|:
  Fly   436 DKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFM 500

  Fly   320 PWIKSNLENT 329
            .||...:::|
  Fly   501 DWIIQQVQDT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/249 (35%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 86/247 (35%)
Tryp_SPc 261..503 CDD:238113 86/246 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.