DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and KLK1

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:251 Identity:77/251 - (30%)
Similarity:121/251 - (48%) Gaps:29/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDH---DQE 157
            |||||.....:..||.|.:.:...|.|||.|:.:.:||:||||:    ....::..|.|   |.|
Human    24 RIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCI----SDNYQLWLGRHNLFDDE 84

  Fly   158 ITSESQAIQRA-------VTAVIKHKSFDPDTYNNDIALLRLRKPI-SFSKIIKPICLPRYNYDP 214
            .|::...:..:       ::.:..|.....:.|::|:.||||.:|. :.:..:|.:.||  ..:|
Human    85 NTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELP--TEEP 147

  Fly   215 -AGRIGTVVGWGRTS-EGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RPSMDSC 275
             .|......|||... |....|..:..|.:.|:...||:....:  ::|..|||.|  ....|:|
Human   148 EVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQ--KVTDFMLCVGHLEGGKDTC 210

  Fly   276 QGDSGGPLLLSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSNL-ENT 329
            .|||||| |:.:||   :.|:.||| |.||....|.|..||..::.||:..: ||:
Human   211 VGDSGGP-LMCDGV---LQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 74/243 (30%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.