DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG13744

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:268 Identity:93/268 - (34%)
Similarity:142/268 - (52%) Gaps:24/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ENSSLKNCDCDCGF-----SNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAA 136
            :::.|.|...:||.     :..:.||:||:|....:|||.|.|.. .::.|||.|::.:.|.:||
  Fly   117 DDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAA 180

  Fly   137 HCVKKLRKSKIRVIFGDHDQE----ITSESQAIQRAVTAVIKHKSFD-----PDTYNNDIALLRL 192
            ||:::...:.|.|..|:.|.:    |.......:..|...|.|..|:     ||.|  |||||:|
  Fly   181 HCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY--DIALLKL 243

  Fly   193 RKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSE--GGELPSIVNQVKVPIMSITEC---RN 252
            .:|.||::.|.|||||:|.....||.|.:.|||:|..  |....:::....|||::..:|   ..
  Fly   244 AQPTSFTEHILPICLPQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHE 308

  Fly   253 QRYKSTRITSSMLCAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRV 315
            .:..:..|.:.|.|||...  ||:|.|||||||::....::.:|||.|.|.|||.:..||:|..|
  Fly   309 SKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNV 373

  Fly   316 SKFIPWIK 323
            .|.:.||:
  Fly   374 QKTVRWIQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/243 (36%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 87/241 (36%)
Tryp_SPc 142..383 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.