DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and flz

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:265 Identity:102/265 - (38%)
Similarity:148/265 - (55%) Gaps:18/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TENSSLKNCDCDCGFSN--EEIRIVGGKPTGVNQYPWMARI---VYDGKF---HCGGSLLTKDYV 132
            |.|.:..:...:||...  :..||||||.:....|||...:   .:.|.|   .|||.|:|..||
  Fly  1426 TPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYV 1490

  Fly   133 LSAAHCVKKLRKSKIRVIFGDHDQEITSES-QAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPI 196
            ::||||......|.:.|: |:.|.....|| :::.:.|..||.|:.:||.|:.||:|||.|..|:
  Fly  1491 ITAAHCQPGFLASLVAVM-GEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPV 1554

  Fly   197 SFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRY---KST 258
            .|...|.|||:|....|..||:.||.||||...||.:||::.:|:|||:..:.|:...:   .:.
  Fly  1555 QFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNK 1619

  Fly   259 RITSSMLCAG--RPSMDSCQGDSGGPLLLS--NGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFI 319
            :|.:|.||||  ....|||:|||||||:|.  :| :|.:.|.||.|:.|.....||||.|.:.:.
  Fly  1620 KILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDG-RYELAGTVSHGIKCAAPYLPGVYMRTTFYK 1683

  Fly   320 PWIKS 324
            ||::|
  Fly  1684 PWLRS 1688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 97/242 (40%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 97/242 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457810
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.