DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG8586

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:286 Identity:91/286 - (31%)
Similarity:133/286 - (46%) Gaps:54/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NSSLKNCDCDCGFSN--------------EEIRIVGGKPTGVNQYPWMARIVYDGK--FHCGGSL 126
            |...||    ||:||              |::.|.|       ::|||..| :.|:  |.|||:|
  Fly   166 NFKYKN----CGYSNPKGLIPDNDKFPYSEDVSIFG-------EFPWMVGI-FTGRQEFLCGGTL 218

  Fly   127 LTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRA-VTAVIKHKSFDPDTYNNDIALL 190
            :....|::.:|.:.......:....||.|....:|....|.: :..:|.|..|||::..||||||
  Fly   219 IHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALL 283

  Fly   191 RLRKPISFSKIIKPICLPRYNYDPAGRIGT---------VVGWGRTSEGG--ELPSIVNQVKVPI 244
            .|.:||..:..|:|:|||    .|.....|         ..||| |.|.|  :|..::.::.:|:
  Fly   284 LLDEPIRLAPHIQPLCLP----PPESPELTNQLLSVTCYATGWG-TKEAGSDKLEHVLKRINLPL 343

  Fly   245 MSITEC----RNQRYKST-RITSSMLCA-GRPSMDSCQGDSGGPL---LLSNGVKYFIVGIVSWG 300
            :...||    ||.|.::. |:..|.:|| |.|..|:|:||.|.||   :.....:|.:|||||||
  Fly   344 VEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWG 408

  Fly   301 VGCGREGYPGVYSRVSKFIPWIKSNL 326
            |.|..|..|.||..|.....||...:
  Fly   409 VECAVEDIPAVYVNVPHLRGWIDEKI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 83/250 (33%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 82/248 (33%)
Tryp_SPc 197..430 CDD:214473 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.