DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss21

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:132/270 - (48%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152
            ||......|||||:...:.::||...:...|...||.:||.:.:||:||||.:|           
  Rat    49 CGHRTIPSRIVGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQK----------- 102

  Fly   153 DHDQ--------EITSES-----QAIQRAVTAVIKHKSFDP---DTYNNDIALLRLRKPISFSKI 201
            |:|.        |:||..     ||......  |:.....|   :.:.:|||||:|..|:::|..
  Rat   103 DNDPFDWTVQFGELTSRPSLWNLQAYSNRYQ--IEDIFLSPKYTEQFPHDIALLKLSSPVTYSNF 165

  Fly   202 IKPICLPRYNYDPAGRIGT-VVGWGRTSEGGE--LPSIVNQVKVPIMSITECRNQRYKS----TR 259
            |:||||....|..|.|... |.|||...|...  ||:.:.:|:|.|::.|.| |..:|.    ..
  Rat   166 IQPICLLNSTYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMC-NHLFKKPDFRIN 229

  Fly   260 ITSSMLCAGRP--SMDSC---------QGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYS 313
            |...|:|||.|  ..|:|         ||||||||:.:....::.||:||||:||||...||||:
  Rat   230 IWGDMVCAGSPEGGKDACFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGIGCGRPNRPGVYT 294

  Fly   314 RVSKFIPWIK 323
            .:|....||:
  Rat   295 NISHHYNWIR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 90/261 (34%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 89/259 (34%)
Tryp_SPc 58..304 CDD:238113 89/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.