DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG4793

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:252 Identity:73/252 - (28%)
Similarity:132/252 - (52%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHC---GGSLLTKDYVLSAAHCVKKLRKSKIRVI 150
            ||:....|.:..|    .:.|||..:: |.:...   ||||:|:|.||:::....::.:..:.|.
  Fly    95 GFTITNARDIAQK----GELPWMVALL-DSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVR 154

  Fly   151 FGDHDQEITSESQAIQR-AVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDP 214
            .|:.|.|..:|.:|.:. |:..:::|.:...:...|:.|||.|.:|:.....|..||||..|.:.
  Fly   155 AGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF 219

  Fly   215 AGRIGTVVGWG-RTSEGGELPSIVNQVKVPIMSITECRNQRY----KSTRITSSMLCA-GRPSMD 273
            ......|.||| :|:......:|:.::::|::..:.|:.:..    |...:.:|::|| |.|..|
  Fly   220 IHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKD 284

  Fly   274 SCQGDSGGPL---LLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327
            :|:||.|.||   |.|:..:|.::|||::|.|||.. .|..|:.||:...||.:.::
  Fly   285 TCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 70/240 (29%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 70/237 (30%)
Tryp_SPc 105..335 CDD:214473 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.