DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:312 Identity:108/312 - (34%)
Similarity:159/312 - (50%) Gaps:39/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GFNESDAINTIHTGHNKRTSKFLFDTIFRISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFS 91
            |.:|.:...:|..  |.||.|...|..||..:        :..:..|:..:.|..:.|.|... |
Human   547 GRDEQNCTQSIPC--NNRTFKCGNDICFRKQN--------AKCDGTVDCPDGSDEEGCTCSRS-S 600

  Fly    92 NEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQ 156
            :...||:||..|....:||...:.:.|..:||.|:::::::||||||....|.|...........
Human   601 SALHRIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGM 665

  Fly   157 EITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRL--RKPISFSKIIKPICLPRYNYDPAG--- 216
            .:...::.:. .|..::.|:.::..|::.|||||:|  ..|.:..::|:|||:|     |.|   
Human   666 YVQGNAKFVS-PVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIP-----PTGQRV 724

  Fly   217 RIGT---VVGWGRTSEGGELPSIV-NQVKVPIMSITECRNQRYKSTR--ITSSMLCAGRPS--MD 273
            |.|.   |.||||..|.....|:| .|.:|.::..|.|     .||.  |||.|||||..|  .|
Human   725 RSGEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLC-----VSTYGIITSRMLCAGIMSGKRD 784

  Fly   274 SCQGDSGGPLLL---SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
            :|:|||||||..   |:| |:.:.||||||.|.||..:||||:|||.|:|||
Human   785 ACKGDSGGPLSCRRKSDG-KWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 92/242 (38%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.