DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and prss60.3

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:251 Identity:90/251 - (35%)
Similarity:138/251 - (54%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CGFSNEEIRIVGGKPTGVNQYPWMARI---VYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRV 149
            ||.:....|||||.......:||...:   .|.|.| |||||::.::||:||||:..:.::.:.|
Zfish    27 CGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHF-CGGSLISSEWVLTAAHCLSGVSETTLVV 90

  Fly   150 IFGDHDQE---ITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYN 211
            ..|...|:   |...|:.:.::..    |.|::.:|.:||||||||...::|:..|:|:||...|
Zfish    91 YLGRRTQQGINIYETSRNVAKSFV----HSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQN 151

  Fly   212 --YDPAGRIGTVVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RP 270
              |. ||....:.|||....|..||:  |:.:..:|:::...| |....|..:|::|:|||  :.
Zfish   152 SVYS-AGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC-NALLGSGTVTNNMICAGLTQG 214

  Fly   271 SMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
            ..|:||||||||::......:...||.|||.||.....||||:|||::..||.|.:
Zfish   215 GKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/239 (36%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 86/239 (36%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.