DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG18557

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:291 Identity:78/291 - (26%)
Similarity:125/291 - (42%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYD-GK 119
            ::.|.||..||..|.:||                       :...||   |::||...::.: ..
  Fly    69 LNCGKSNPNGLGGTVEEV-----------------------VDQAKP---NEFPWTVALMQNLIN 107

  Fly   120 FHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYN 184
            |...|:|:|::.|::|||.:.....:...:|.|..|.:..:......|..|.::.|..|:..|..
  Fly   108 FFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGA 172

  Fly   185 NDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIV--------NQVK 241
            |:|||:.|.........|.|||.|............|.||||       |..:        .::.
  Fly   173 NNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKID 230

  Fly   242 VPIMSITEC-----RNQRYKSTRITSSMLCA-GRPSMDSCQGDSGGPLLL---SNGVKYFIVGIV 297
            :||:|.::|     |....:|.::..::||| |....|:|.||.|.||:.   .:...|.:||||
  Fly   231 LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIV 295

  Fly   298 SWGVGCGREGYPGVYSRVSKFIPWIKSNLEN 328
            :.|..||.|..|.:|:.:|...|||:..|.:
  Fly   296 NSGFSCGLENVPALYTNISHMRPWIEKQLND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 69/245 (28%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/244 (28%)
Tryp_SPc 90..320 CDD:214473 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.