DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG11912

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:254 Identity:75/254 - (29%)
Similarity:119/254 - (46%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFH-CGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152
            ||  .|.||:.|......:.|::..:......| |.||||.:..:::||||   |..::.:.:.|
  Fly    24 GF--PEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHC---LTYNQGQAVAG 83

  Fly   153 DHDQEITSESQAIQRAVTA-VIKHKSFDPDTYNNDIALLRLRKPISF---------SKIIKPICL 207
            .|.: ...|:..|::...| .:.|:::......|||.|:.|::..:|         |..:..:.|
  Fly    84 AHSR-TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSL 147

  Fly   208 PRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSM 272
            |...:..... |.:.|||| ...|.||..:.::...|:...||:.....:..:..:.:|...|..
  Fly   148 PSKTFQGTSD-GYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGK 210

  Fly   273 --DSCQGDSGGPLL---LSNGVKYFIVGIVSWG-VGCGREGYPGVYSRVSKFIPWIKSN 325
              .||.|||||||:   .|.|.:  ::|||||| ..|....||.||:.||.|:|||..|
  Fly   211 ADGSCNGDSGGPLVSQSSSRGAE--LIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDEN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 70/244 (29%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 69/242 (29%)
Tryp_SPc 30..267 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.