DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG1304

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:241 Identity:77/241 - (31%)
Similarity:113/241 - (46%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK---------LRKSKIRVIF 151
            |:|||:....||:|....:...|...||||:|:::|||:|||||..         :...:..:..
  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRA 95

  Fly   152 GDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAG 216
            |.:|:    .|..:...|..||.|:.:  ..:.||:|||||..|:..|..|:||.||..: .||.
  Fly    96 GSNDR----FSGGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILSASIQPIDLPTAD-TPAD 153

  Fly   217 RIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMDSCQGDSGG 281
            ....:.||||....|:||..:....:..:|:..|  .......:.|.:.........:|.|||||
  Fly   154 VDVIISGWGRIKHQGDLPRYLQYNTLKSISLERC--DELIGWGVQSELCLIHEADNGACNGDSGG 216

  Fly   282 PLLLSNGVKYFIVGIVS--WGVGCGREGYPGVYSRVSKFIPWIKSN 325
            |.:.:|.|    ||:..  |. .|| ..||..|:||.....|||:|
  Fly   217 PAVYNNQV----VGVAGFVWS-ACG-TSYPDGYARVYYHNEWIKNN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 75/238 (32%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/236 (31%)
Tryp_SPc 32..256 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.