DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss53

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:122/263 - (46%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHC-VK 140
            |||.:.     ||    .:|..|.:...::|:||.||:.:.||..|||:|:::..||:|||| :.
Mouse   290 ENSCVA-----CG----SLRSAGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIG 345

  Fly   141 KLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPI 205
            :....:..|..|...:|         ..:..:|.|.::.......|:|.|.|.:|::....::|:
Mouse   346 RQTLEEWSVGLGAGPEE---------WGLKQLILHGAYTHPEGGYDVAFLLLAQPVTLGPGLRPL 401

  Fly   206 CLPRYNYD-PAGRIGTVVGWGRTSEGGELPSIVN---QVKVPIMSITECRNQRY----KSTRITS 262
            |||..::. |.|..|.|:  |.|.:.|     :|   .|.|.::....|..|..    ....|..
Mouse   402 CLPYADHHLPDGEHGWVL--GLTQKAG-----INYPQTVPVTVLGPMACSRQHAAPGGTGIPILP 459

  Fly   263 SMLC---AGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKS 324
            .|:|   .|.|  ..|:|.||.||:......:|:||:.|:|..|.....|.|::.:|.:..|| |
Mouse   460 GMVCTTVVGEP--PHCEGLSGAPLVHEIRGTWFLVGLHSFGDTCQSSAKPAVFAALSAYEDWI-S 521

  Fly   325 NLE 327
            ||:
Mouse   522 NLD 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 66/239 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 65/229 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.