DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss34

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:268 Identity:93/268 - (34%)
Similarity:135/268 - (50%) Gaps:45/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DCGFSNEEIRIVGGKPTGVNQYPWMARI-VYD-----GKFHCGGSLLTKDYVLSAAHCV--KKLR 143
            |.|.....:.||||.|...:::||...: :||     .:..|||||:...:||:|||||  |::.
Mouse    25 DLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVE 89

  Fly   144 KSKIRVIFG-----DHDQEITSESQAIQRAVTAVIKHKSFDPDTY---NNDIALLRLRKPISFSK 200
            ...:||..|     ::||.:         .|..:|:|..|.....   ..|||||:|...:..|:
Mouse    90 AYGVRVQVGQLRLYENDQLM---------KVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSE 145

  Fly   201 IIKPICLPRYNYDPAGRIGT-----VVGWGRTSEGGELPS--IVNQVKVPIMSITECRNQRYK-- 256
            .:.|:.||..:.    ||.:     |.|||.......||.  .:.:|.|||:...:| .|:|:  
Mouse   146 HVYPVSLPAASL----RISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDC-EQKYQTN 205

  Fly   257 -----STR-ITSSMLCAGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRV 315
                 :|| |...|||||:...|||:.||||||:......:..||:||||:|||...:||||:||
Mouse   206 SSSDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRV 270

  Fly   316 SKFIPWIK 323
            ..::.|||
Mouse   271 MSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 91/258 (35%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 89/256 (35%)
Tryp_SPc 35..277 CDD:214473 88/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.