DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG9673

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:254 Identity:71/254 - (27%)
Similarity:123/254 - (48%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK-----LRKSKIRVIFGDHD 155
            ||:||:.....:|||.|.:.|:....|.|::::.:::|:|||||..     :..|.:.|..|..:
  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTIN 92

  Fly   156 Q----EITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYD--- 213
            |    .|.:        |.:||.|.|:  ..:.:|||:|.|.:.:.||..|:.|.||....:   
  Fly    93 QYAGGSIVN--------VKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDIALPPTTDEETE 147

  Fly   214 ------PAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITE--CRNQRYKSTRITSSMLCAGRP 270
                  |.|....|.|||..|:|   .:...|.|....:::.  |   .:::.....|::|..|.
  Fly   148 DVDAELPNGTPVYVAGWGELSDG---TASYKQQKANYNTLSRSLC---EWEAGYGYESVVCLSRA 206

  Fly   271 SMDS-CQGDSGGPLLLSNGVKYFIVGIVSWGVG-CGREGYPGVYSRVSKFIPWIKSNLE 327
            ..:. |:||:|..::..:.|   :.|:.|:..| ||.: ||.|.:|||.::.||::|.:
  Fly   207 EGEGICRGDAGAAVIDDDKV---LRGLTSFNFGPCGSK-YPDVATRVSYYLTWIEANTQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 69/249 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/247 (28%)
Tryp_SPc 29..259 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.