DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG33160

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:234 Identity:76/234 - (32%)
Similarity:117/234 - (50%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160
            ||:||..:.:.:..::.::....:. |||||:...:|::|||||....|:..::..|..:|   :
  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQ---A 93

  Fly   161 ESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWG 225
            ...|:.|.|..:.....|:..|.|.|:|.|||...: ....|:.|.|...:. ||..:..|.|||
  Fly    94 GPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQSV-PARALVKVSGWG 156

  Fly   226 -RTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGR-PSMDSCQGDSGGPLLLSNG 288
             .|::..:....|:.|.||:.|...|.:......|||.||:||.| ...|||.|||||||:....
  Fly   157 FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQ 221

  Fly   289 VKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327
                :.||||:|.||. ...||:|:.|.:...|.:..:|
  Fly   222 ----LAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 74/229 (32%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/226 (33%)
Tryp_SPc 34..253 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.