DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and HPN

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:295 Identity:105/295 - (35%)
Similarity:156/295 - (52%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SSGVSNAFGLSDTEDEVEYTEN--SSLKNCDC-----------DCGFSNEEI-RIVGGKPTGVNQ 107
            ::|.|..|.:.  |..:.:|:.  ..:..|||           |||.....: |||||:.|.:.:
Human   111 ANGTSGFFCVD--EGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGR 173

  Fly   108 YPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRK--SKIRVIFGDHDQEITSESQAIQRAVT 170
            :||...:.|||...||||||:.|:||:||||..:..:  |:.||..|...|   :....:|..|.
Human   174 WPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQ---ASPHGLQLGVQ 235

  Fly   171 AVIKHKSF----DPDT--YNNDIALLRLRKPISFSKIIKPICLPRYNYDPA-GRIGTVVGWGRTS 228
            ||:.|..:    ||::  .:|||||:.|..|:..::.|:|:|||....... |:|.||.|||.|.
Human   236 AVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ 300

  Fly   229 EGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP--SMDSCQGDSGGPLLLSNGV-- 289
            ..|:...::.:.:|||:|...|....:...:|...|.|||.|  .:|:||||||||.:..:.:  
Human   301 YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISR 365

  Fly   290 --KYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322
              ::.:.||||||.||.....||||::||.|..||
Human   366 TPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 93/241 (39%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 11/49 (22%)
Tryp_SPc 163..400 CDD:238113 91/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.