DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and CG32376

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:237 Identity:78/237 - (32%)
Similarity:126/237 - (53%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQ---E 157
            |||.||.....:.|:...:.|:|.|.||..::.|.::|:|.||           .||..::   .
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHC-----------FFGPPEKYTVR 118

  Fly   158 ITSESQ---AIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIG 219
            :.|:.|   ...|.|..::...:::..|..:|:|:::|:.|:.|.|.::|:.||........:..
  Fly   119 VGSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKF 183

  Fly   220 TVVGWGRTSEGGE-LPSIVNQVKVPIMSITECRNQRYKST--RITSSMLCAGRPSMDSCQGDSGG 281
            .|.|||.||...: :...:.:|::..:..::|: :.||..  :|...|:||.|.:.|||.|||||
  Fly   184 VVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQ-KMYKKAGLKIYKDMICASRTNKDSCSGDSGG 247

  Fly   282 PLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIK 323
            | |.|.||.|   ||||||:||..:.|||||....:::||||
  Fly   248 P-LTSRGVLY---GIVSWGIGCANKNYPGVYVNCKRYVPWIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 77/236 (33%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 75/234 (32%)
Tryp_SPc 66..287 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.