DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:253 Identity:86/253 - (33%)
Similarity:131/253 - (51%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DCGFS--NEEIRIVGGKPTGVNQYPWMARIVYDGKFH-CGGSLLTKDYVLSAAHCVKKLRKSKIR 148
            |||.:  ....|||||....:.::||...:....:.| ||..|:.:.::||||||..        
  Rat   852 DCGLAPPGALTRIVGGSAASLGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFD-------- 908

  Fly   149 VIFGDHDQ-------EITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPIC 206
             ::||..|       ...|.::.....|..:.:|..::..|.:.|:|||.|..|:..|::::|||
  Rat   909 -VYGDPMQWAAFLGTPFLSSTEGQLERVARIYRHPFYNIYTLDYDVALLELAGPVRRSRLVRPIC 972

  Fly   207 LPRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP- 270
            ||.....|.|....:.|||...|||.:...:.:..|.::|...||  |:...:|:|.|||||.| 
  Rat   973 LPGPTRPPEGARCVITGWGSLREGGSMARQLQKAAVRVLSEQTCR--RFYPVQISSRMLCAGFPQ 1035

  Fly   271 -SMDSCQGDSGGPLLLSN-GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326
             .:|||.||:||||.... ..::.:.|:.|||.||||..:||||:||:..:.||..|:
  Rat  1036 GGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHFPGVYTRVAAVLGWIGQNI 1093

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 81/238 (34%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.