DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:252 Identity:92/252 - (36%)
Similarity:140/252 - (55%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSK-- 146
            |....|:|.   |||||..:.:.|:||...:.:.|...||||::|..::::|||||..|...|  
  Rat   207 CGMRTGYSP---RIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYHPKSW 268

  Fly   147 -IRV-IFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR 209
             ::| :....|..:.|      ..|..:|.|..:.|....|||||::|.:|::|.:.|:|||||.
  Rat   269 TVQVGLVSLMDSPVPS------HLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPN 327

  Fly   210 YNYD-PAGRIGTVVGWGRTSEG-GELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAG--RP 270
            ...: |.|::....|||.|.:| |:...::|...||::|...|.::......|:.||||||  :.
  Rat   328 SEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKG 392

  Fly   271 SMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327
            .:|||||||||||:......:.:||..|:|:||.....||||:|::.|:.||...||
  Rat   393 GVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQLE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/235 (37%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 1/3 (33%)
Tryp_SPc 216..444 CDD:214473 85/233 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.