DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Klk8

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:239 Identity:86/239 - (35%)
Similarity:127/239 - (53%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD-QEIT 159
            :|:.|:....:..||...:....:..|||.|:...:||:||||    :|.|..|..|||. |:..
  Rat    32 KILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHC----KKDKYSVRLGDHSLQKRD 92

  Fly   160 SESQAIQRAVTAVIKHKSF---DPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDP-AGRIGT 220
            ...|.||  |...|:|..|   :|:.:::||.|:||:...:....:|||.|.  |..| .|:...
  Rat    93 EPEQEIQ--VARSIQHPCFNSSNPEDHSHDIMLIRLQNSANLGDKVKPIELA--NLCPKVGQKCI 153

  Fly   221 VVGWGR-TSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPS-MDSCQGDSGGPL 283
            :.|||. ||.....|:.:|..:|.|.|..:|  :|....:||..|:|||..: .|:|||||||| 
  Rat   154 ISGWGTVTSPQENFPNTLNCAEVKIYSQNKC--ERAYPGKITEGMVCAGSSNGADTCQGDSGGP- 215

  Fly   284 LLSNGVKYFIVGIVSWGVG-CGREGYPGVYSRVSKFIPWIKSNL 326
            |:.|||   :.||.|||.. ||:...||||:::.::..|||..:
  Rat   216 LVCNGV---LQGITSWGSDPCGKPEKPGVYTKICRYTNWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/235 (37%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 83/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.