DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11836 and Prss22

DIOPT Version :9

Sequence 1:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:256 Identity:88/256 - (34%)
Similarity:132/256 - (51%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKL--RKSKIRV 149
            |||...:..|:|||:.:...|:||:..|:.:|..||.|||||..:|:|||||....  :.|...|
  Rat    40 DCGKPQQLNRVVGGEDSADAQWPWIVSILKNGSHHCAGSLLTNRWVVSAAHCFSSNMDKPSPYSV 104

  Fly   150 IF--------GDHDQEITSESQAIQRAVTAVIKHKSFD-PDTYNNDIALLRLRKPISFSKIIKPI 205
            :.        |...|::         .:.:|:.|..:. .:..:.||||:||.:||.||:.|.||
  Rat   105 LLGAWKLGNPGPRSQKV---------GIASVLPHPRYSRKEGTHADIALVRLERPIQFSERILPI 160

  Fly   206 CLPRYN-YDPAGRIGTVVGWGRTSEGGEL--PSIVNQVKVPIMSITECRNQRYKST---RITSSM 264
            |||..: :.|......:.|||...:|..|  |..:.::||||:....|::..::..   .||..|
  Rat   161 CLPDSSVHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDM 225

  Fly   265 LCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIK 323
            ||||  ....|:|.|||||||:......:.:.||:|||.||.....||||:.:....||::
  Rat   226 LCAGYLEGKRDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAHRPWVQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 84/246 (34%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 84/244 (34%)
Tryp_SPc 50..288 CDD:238113 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.